2.20 Rating by ClearWebStats
mayhomesolutions.com is 5 years 5 months 3 weeks old. This website has a #8,044,746 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, mayhomesolutions.com is SAFE to browse.
Get Custom Widget

Traffic Report of Mayhomesolutions

Daily Unique Visitors: 60
Daily Pageviews: 120

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 8,044,746
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View mayhomesolutions.com site advisor rating Not Applicable

Where is mayhomesolutions.com server located?

Hosted IP Address:

199.34.228.77 View other site hosted with mayhomesolutions.com

Hosted Country:

mayhomesolutions.com hosted country US mayhomesolutions.com hosted country

Location Latitude:

37.7642

Location Longitude:

-122.3993

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View mayhomesolutions.com HTML resources

Homepage Links Analysis

MAY HOME SOLUTIONS - Home

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 5
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: UA-7870337-1

Websites Hosted on Same IP (i.e. 199.34.228.77)

Eden Council for Hope and Opportunity - Home

mayhomesolutions.com favicon - echofairhousing.org

View mayhomesolutions.com Pagerank   mayhomesolutions.com alexa rank 10,245,081   mayhomesolutions.com website value $ 8.95

Schweizerischer KMU Verband - Über uns...

mayhomesolutions.com favicon - kmuverband.ch

Offizielle WebSite des Schweizerischen KMU Verbandes

View mayhomesolutions.com Pagerank   mayhomesolutions.com alexa rank 1,918,530   mayhomesolutions.com website value $ 480.00

Home

mayhomesolutions.com favicon - rohrabacher.com

Congressman Rohrabacher is a former Reagan speechwriter and long time champion for economic freedom, limited government and individual liberty.

View mayhomesolutions.com Pagerank   mayhomesolutions.com alexa rank 5,737,347   mayhomesolutions.com website value $ 240.00

Solutions de courrier hybride multi-canales & intelligentes - Nirva Software - Restoring Simplicity

mayhomesolutions.com favicon - nirva-software.fr

Avec PostGreen, envoyez vos courriers, recommandés & emails directement depuis vos applications métiers, PC, Mac, tablette ou smartphone en un clic. C'est plus simple, plus rapide, plus sécurisé, plus économique et plus écologique.

View mayhomesolutions.com Pagerank   mayhomesolutions.com alexa rank Not Applicable   mayhomesolutions.com website value $ 8.95

Pitty Rescue Inc. - Home

mayhomesolutions.com favicon - pittyrescue.com

View mayhomesolutions.com Pagerank   mayhomesolutions.com alexa rank Not Applicable   mayhomesolutions.com website value $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 08 Dec 2018 16:12:06 GMT
Server: Apache
Vary: X-W-SSL,Accept-Encoding,User-Agent
Cache-Control: private
ETag: W/"6aa17d897c0643457ed3313fe8fb8f9c-gzip"
Content-Encoding: gzip
X-Host: pages44.sf2p.intern.weebly.net
X-UA-Compatible: IE=edge,chrome=1
Content-Length: 7876
Content-Type: text/html; charset=UTF-8

Domain Information for mayhomesolutions.com

Domain Registrar: REGISTER.COM, INC. mayhomesolutions.com registrar info
Registration Date: 2018-11-08 5 years 5 months 3 weeks ago
Last Modified: 2018-11-08 5 years 5 months 3 weeks ago

Domain Nameserver Information

Host IP Address Country
dns1.register.com mayhomesolutions.com name server information 162.159.27.248 mayhomesolutions.com server is located in Unknown or Invalid Region Unknown or Invalid Region
dns2.register.com mayhomesolutions.com name server information 162.159.26.197 mayhomesolutions.com server is located in Unknown or Invalid Region Unknown or Invalid Region

DNS Record Analysis

Host Type TTL Extra
mayhomesolutions.com A 3599 IP:199.34.228.77
mayhomesolutions.com NS 3599 Target:dns017.c.register.com
mayhomesolutions.com NS 3599 Target:dns204.b.register.com
mayhomesolutions.com NS 3599 Target:dns043.a.register.com
mayhomesolutions.com NS 3599 Target:dns083.d.register.com
mayhomesolutions.com SOA 3599 MNAME:dns043.a.register.com
RNAME:root.register.com
Serial:2018110802
Refresh:28800
Retry:7200
Expire:604800
mayhomesolutions.com MX 3599 Priority:5
Target:alt2.aspmx.l.google.com
mayhomesolutions.com MX 3599 Priority:1
Target:aspmx.l.google.com
mayhomesolutions.com MX 3599 Priority:10
Target:alt3.aspmx.l.google.com
mayhomesolutions.com MX 3599 Priority:5
Target:alt1.aspmx.l.google.com
mayhomesolutions.com MX 3599 Priority:10
Target:alt4.aspmx.l.google.com

Similarly Ranked Websites to Mayhomesolutions

Great Canadian Rivers and Salmon Undercurrents

mayhomesolutions.com favicon - greatcanadianrivers.com

Take a multimedia tour of Canadian rivers. Explore the history, ecosystems, culture, recreation and industry of Canada's greatest waterways. Facts, figures and descriptions include natural environment, fish and wildlife, salmon species, outdoor travel, eco-tourism, parks, trails, sport fishing, whitewater canoeing, kayaking, cycling, hiking, birdwatching, First Nations cultures, historical figures and events, heritage and historic sites,...

View mayhomesolutions.com Pagerank   Alexa rank for mayhomesolutions.com 8,044,752   website value of mayhomesolutions.com $ 8.95

xxx

mayhomesolutions.com favicon - smmpaneliturkiye.com

View mayhomesolutions.com Pagerank   Alexa rank for mayhomesolutions.com 8,044,757   website value of mayhomesolutions.com $ 8.95

Anything and Everything Wisconsin, your complete Wisconsin vacation guide

mayhomesolutions.com favicon - anythingwisconsin.com

Anything and Everything Wisconsin, resorts, campgrounds, hotels, fishing and hunting guides, beer, cheese, the best of Wisconsin and all it has to offer.

View mayhomesolutions.com Pagerank   Alexa rank for mayhomesolutions.com 8,044,765   website value of mayhomesolutions.com $ 8.95

403 Forbidden

mayhomesolutions.com favicon - barkatagro.com

View mayhomesolutions.com Pagerank   Alexa rank for mayhomesolutions.com 8,044,769   website value of mayhomesolutions.com $ 8.95

Account Suspended

mayhomesolutions.com favicon - resellerflipkartdailydhamaka.info

View mayhomesolutions.com Pagerank   Alexa rank for mayhomesolutions.com 8,044,772   website value of mayhomesolutions.com $ 8.95

Full WHOIS Lookup for mayhomesolutions.com

Domain Name: MAYHOMESOLUTIONS.COM
Registry Domain ID: 2330881272_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.register.com
Registrar URL: http://www.register.com
Updated Date: 2018-11-08T20:29:17Z
Creation Date: 2018-11-08T20:29:16Z
Registry Expiry Date: 2019-11-08T20:29:16Z
Registrar: Register.com, Inc.
Registrar IANA ID: 9
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.8003337680
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: DNS1.REGISTER.COM
Name Server: DNS2.REGISTER.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-12-08T16:11:57Z